PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr039118.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 478aa    MW: 53770.2 Da    PI: 6.2096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr039118.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.3e-141559348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W++eEd++l + +  +G+++W+ Ia+++   +t  qc+ rw++yl
      Pbr039118.1 15 TWSQEEDDILRNQISIHGTENWAIIASKFK-DKTTRQCRRRWYTYL 59
                     6****************************9.*************97 PP

2Myb_DNA-binding43.66.6e-1465108146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
      Pbr039118.1  65 KGGWSPEEDMLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 108
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.872859IPR017930Myb domain
SMARTSM007173.5E-131261IPR001005SANT/Myb domain
SuperFamilySSF466891.14E-2512106IPR009057Homeodomain-like
CDDcd001671.21E-121559No hitNo description
Gene3DG3DSA:1.10.10.602.6E-201666IPR009057Homeodomain-like
PfamPF139219.7E-151676No hitNo description
PROSITE profilePS5129420.05560114IPR017930Myb domain
SMARTSM007171.1E-1464112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-1967113IPR009057Homeodomain-like
CDDcd001671.54E-1068109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MPQEESKKKE RHIVTWSQEE DDILRNQISI HGTENWAIIA SKFKDKTTRQ CRRRWYTYLN  60
SDFKKGGWSP EEDMLLCEAQ KIFGNRWTEI AKVVSGRTDN AVKNRFSTLC KKRAKYEALA  120
KENAASYINQ NDKRVIIRNG FNTDGTAETT APSKKMRRSH IPSLSEGDRL LEQCGKMSQQ  180
LRAPFAVLIQ NVHNVENLPD QNNVNSTKEV HVNAVQKSKF QGSFLKKDDP KIIALMQQAE  240
LLSSLALKVN AENTDQSLEN AWKVLQDFLN QSKDGDILSY GINDFDFQLE DLKYLLEDFM  300
STTEGSRPSW QQPDLYDESP GSSEYSTGST LLSQTEYYQV EQNKVEIGSL NQEIQPGSQS  360
IPIEGKNGVG DCEKGNFSKK QEIFPSCDEA TKDYAVVSAL SSTEFNSPIK VTPLFRSLAA  420
GIPSHKFSES ERNFLLKTLG EDSPCPNPST NPSQPPPCKT IPPPKSITNL FDPPPHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-261611310107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008389498.10.0PREDICTED: transcription factor MYB51 isoform X3
TrEMBLD9ZJ680.0D9ZJ68_MALDO; MYB domain class transcription factor
STRINGVIT_01s0026g01910.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-162myb domain protein 88